***Human SLC34A2 Protein, 100 µg, Ship with an Ice Pack

Biorbyt

SKU:

ORB419212100UG

Pending approval

(No reviews yet)

Gift wrapping:

Options available

Current Stock:

Quantity:

Adding to cart… The item has been added

Recombinant Human Sodium-dependent phosphate transport 2B

Tag: N-terminal 6xHis-B2M-tagged
Form/Appearance: Liquid or Lyophilized powder
Purity: Greater than 85% as determined by SDS-PAGE.
MW: 27.1 kDa
UniProt ID: O95436
Protein Sequence: LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA
Protein Length: Partial
Source: E.coli
Biological Origin: Homo sapiens (Human)
Expression Region: 574-689aa
Endotoxins: Not test.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Note: For research use only
Application notes: Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 574-689aaSequence Info: Extracellular Domain
Expiration Date: 6 months from date of receipt.