***CYP1A1 Rabbit Polyclonal Antibody, 100 µL, Ship with an Ice Pack

Biorbyt

SKU:

ORB578044

Pending approval

(No reviews yet)

Gift wrapping:

Options available

Current Stock:

Quantity:

Adding to cart… The item has been added

Rabbit polyclonal antibody to CYP1A1

Species/Host: Rabbit
Clonality: Polyclonal
Tested applications: WB
Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
Reactivity: Human, Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1
Concentration: 0.5 mg/ml
Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation: Unconjugated
MW: 58kDa
Target: CYP1A1
UniProt ID: P04798
Protein Sequence: Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV
NCBI: NP_000490
Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Alternative names: AHH, AHRR, CP11, CYP1, CYPIA1, P1-450, P450-C, P450DX
Note: For research use only
Expiration Date: 12 months from date of receipt.