Skip to product information
1 of 1

Bovine IL-17A Recombinant Protein

Bovine IL-17A Recombinant Protein

SKU: KFRP0056B005
Available Quantity : 0

The Bovine IL-17A yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-17A applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-17A yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-17A Specifications: (Molecular Weight: 15.0 kDa) (Amino Acid Sequence: (KAGVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRSTNSRRPTDYHKRSTSPWTLHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIVRHLA) (Gene ID: 282863). For research use only. Made in the USA

Shipping calculated at checkout.
Sales Unit: 5UG

View full details
Description
Specifications
UNSPSC 12352200
Documents
Literature & Videos

RELATED RESOURCES

Tools for Veterinary and Animal Model Research

Tools for Veterinary and Animal Model Research

Sales Unit 5UG

Need Product Assistance?

Our experts are here to help! Contact us for technical support, product recommendations, or order assistance.

Contact Us