***CYP1A1 Rabbit Polyclonal Antibody, 100 µL

Rabbit polyclonal antibody to CYP1A1

• Species/Host:  Rabbit
• Clonality:  Polyclonal
• Tested applications:  WB
• Predicted Reactivity:  Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Sheep, Zebrafish
• Reactivity:  Human, Mouse
• Immunogen:  The immunogen is a synthetic peptide directed towards the middle region of human CYP1A1
• Concentration:  0.5 mg/ml
• Form/Appearance:  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation:  Unconjugated
• MW:  58kDa
• Target:  CYP1A1
• UniProt ID:  P04798
• Protein Sequence:  Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV
• NCBI:  NP_000490
• Storage:  Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives:  Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names:  AHH, AHRR, CP11, CYP1, CYPIA1, P1-450, P450-C, P450DX
• Note:  For research use only
• Expiration Date:  12 months from date of receipt.