SKU: ORB419212100UGAvailable Quantity : 0
Recombinant Human Sodium-dependent phosphate transport 2B
- Tag: N-terminal 6xHis-B2M-tagged
- Form/Appearance: Liquid or Lyophilized powder
- Purity: Greater than 85% as determined by SDS-PAGE.
- MW: 27.1 kDa
- UniProt ID: O95436
- Protein Sequence: LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA
- Protein Length: Partial
- Source: E.coli
- Biological Origin: Homo sapiens (Human)
- Expression Region: 574-689aa
- Endotoxins: Not test.
- Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Note: For research use only
- Application notes: Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 574-689aaSequence Info: Extracellular Domain
- Expiration Date: 6 months from date of receipt.
