***Human SLC34A2 Protein, 20 µg

Recombinant Human Sodium-dependent phosphate transport 2B

• Tag: N-terminal 6xHis-B2M-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 85% as determined by SDS-PAGE.
• MW: 27.1 kDa
• UniProt ID: O95436
• Protein Sequence: LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA
• Protein Length: Partial
• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Expression Region: 574-689aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Note: For research use only
• Application notes: Tag Info: N-terminal 6xHis-B2M-taggedExpression Region: 574-689aaSequence Info: Extracellular Domain
• Expiration Date: 6 months from date of receipt.