SKU: ORB1096059100UGAvailable Quantity : 0
This Recombinant Sudan ebolavirus Envelope glycoprotein (GP), partial spans the amino acid sequence from region 502-637aa. Purity: Greater than 85% as determined by SDS-PAGE.
- Research Area: Infectious Disease & Virology
- Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.
- We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%.
- Source: E.coli
- Biological Origin: Sudan ebolavirus (strain Uganda-00) (SEBOV) (Sudan Ebola virus)
- Tag: N-terminal 6xHis-KSI-tagged
- Expression Region: 502-637aa
- Protein Length: Partial
- MW: 30.8 kDa
- Purity: Greater than 85% as determined by SDS-PAGE.
- Protein Sequence: QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN
- Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Form/Appearance: Liquid or Lyophilized powder
- Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
- Expiration Date: 6 months from date of receipt.
- Disclaimer: For research use only
